-
Notifications
You must be signed in to change notification settings - Fork 20
obtaining marker genes for viral dataset
The benefit of using read2tree is that you don't need to do genome assembly and gene annotation for your samples, as we only need their sequencing reads. However, we need the marker genes of related species as the second input of read2tree.
For eukaryotes and prokaryotes, such input is available on OMA browser, check this instruction.
If you are working with corona virus, you can use this link to download marker genes in addition to downloading the cdna fasta file (1MB) from here and unzip it. Once you have the marker genes as proteome and cnda, you can use the sequencing reads of your samples to infer the species tree all together using read2tree using the argument --standalone_path marker_genes --dna_reference viruses.cdna.fa .
However, when you are working with other viral datasets and want to infer phylogeny using the sequencing reads of your samples, you need some closely related strains/species as reference gene markers. Here we describe how to do so:
First we need to download a set of CDNA from NCBI refSeq for your clade of interest.
As an example, consider you want to study Human orthopneumovirus and we include two outgroup reference species: Murine orthopneumovirus and Bovine orthopneumovirus. We found the link to their CDS and cDNA from NCBI. We can download them using the following
mkdir input_fna; cd input_fna
wget https://ftp.ncbi.nlm.nih.gov/genomes/all/GCA/000/857/565/GCA_000857565.1_ViralProj15251/GCA_000857565.1_ViralProj15251_cds_from_genomic.fna.gz
wget https://ftp.ncbi.nlm.nih.gov/genomes/all/GCA/003/266/525/GCA_003266525.1_ASM326652v1/GCA_003266525.1_ASM326652v1_cds_from_genomic.fna.gz
wget https://ftp.ncbi.nlm.nih.gov/genomes/all/GCA/000/849/305/GCA_000849305.1_ViralProj14697/GCA_000849305.1_ViralProj14697_cds_from_genomic.fna.gz
gunzip -k *.gz
Here we use a python code (available in our github repo read2tree/archive/scripts/clean_fasta_cdna_cds.py) to clean the downloaded fasta files. It also generates the amino-acid sequences using biopython.
We expect that the file extension of fasta files in input_fna is fna.
cd ..
# we are now in myfolder
python clean_fasta_cdna_cds.py input_fna
The output will be :
$ python clean_fasta_cdna_cds.py input_fna
we are not reading the file input_fna/GCA_003266525.1_ASM326652v1_cds_from_genomic.fna.gz since extension is not faa.
we are not reading the file input_fna/GCA_000857565.1_ViralProj15251_cds_from_genomic.fna.gz since extension is not faa.
we are not reading the file input_fna/GCA_000849305.1_ViralProj14697_cds_from_genomic.fna.gz since extension is not faa.
there are 3 fna files, and the first file has 11 sequences in it.
the five letter codes for each faa files are written in clean_five_letter_species.tsv
the clean aa and nuc for s0000 is ready
the clean aa and nuc for s0001 is ready
the clean aa and nuc for s0002 is ready
we wrote 3 faa files in the folder clean_aa and the nucluetide sequences all together in dna_ref.fa
Now you can use the folder with OMA standalone.
$ ls
input_fna clean_aa clean_five_letter_species.tsv dna_ref.fa
$ ls clean_aa
s0000.fa s0001.fa s0002.fa
The folder clean_aa is the output including all the faa files. dna_ref.fa is another output containing all the genomic sequences.
The reason to run this code is that the fasta records contain under score _ which should be removed. Besides, we expect to have a five-letter code for each species name in fasta file names and also the beginning of each fasta record. So this python code solve these issues.
We also expect that the length of each fasta record is a multiply of 3 (each 3 is a codon). We add one or two N to the sequence to make this happen.
The python code create a tsv file showing the new five-letter code assigned to each species.
$ $ cat clean_five_letter_species.tsv
GCA_000849305.1_ViralProj14697_cds_from_genomic.fna s0000
GCA_003266525.1_ASM326652v1_cds_from_genomic.fna s0001
GCA_000857565.1_ViralProj15251_cds_from_genomic.fna s0002
See here what is inside files:
$ head -n3 clean_aa/s0000.fa
>s0000lcl|AF0929421cdsAAC9630111 cleaned for r2t
MGSETLSVIQVRLRNIYDNDKVALLKITCHTNRLILLTHTLAKSVIHTIKLSGIVFIHII
TSSDYCPTSDIINSANFTSMPILQNGGYIWELMELTHCFQTNGLIDDNCEITFSKRLSDS
$ head -n3 dna_ref.fa
>s0000lcl|AF0929421cdsAAC9630111 cleaned for r2t
ATGGGCAGTGAAACATTGAGTGTAATTCAAGTCAGATTAAGGAATATATATGATAATGAT
AAAGTAGCATTGCTTAAAATAACATGTCATACCAATAGATTAATACTTCTAACTCACACA
$ wc -l dna_ref.fa
737 dna_ref.fa
$ head -n2 input_fna/GCA_000849305.1_ViralProj14697_cds_from_genomic.fna
>lcl|AF092942.1_cds_AAC96301.1_1 [gene=NS1] [protein=nonstructural protein 1] [protein_id=AAC96301.1] [location=99..509] [gbkey=CDS]
ATGGGCAGTGAAACATTGAGTGTAATTCAAGTCAGATTAAGGAATATATATGATAATGATAAAGTAGCATTGCTTAAAAT
You can see the difference that only the first part of the record ID is kept and _ or [ is removed.
To infer the orthologous groups we use OMA standalone package. You can follow the description here. But in a nutshell:
wget https://omabrowser.org/standalone/OMA.2.5.0.tgz
tar xvzf OMA.2.5.0.tgz
OMA=/PATH/TO/OMA.2.5.0/bin/oma
mkdir omaWorkingDir; cd omaWorkingDir
cp -r ../clean_aa DB
$ ls DB/
s0000.fa s0001.fa s0002.fa
You could also add the bin folder to your path in ~/.bashrc.
To make sure OMA is working properly, you can run following which prints the OMA help.
${OMA} -h
Now we need to first create the OMA parameter file
${OMA} -p
which creates a file named parameters.drw. Now edit this file and uncomment the line 19-132 and 167 (remove # in the beginning of the lines)
WriteOutput_HOGFasta := false;
WriteOutput_Paralogs := false;
WriteOutput_PhyleticProfileHOG := false;
WriteOutput_PhyleticProfileOG := false;
OutgroupSpecies := 'none';
Now run OMA in the folder that includes DB parameters.drw.
${OMA}
Then we will have OGs in ls omaWorkingDir/Output/OrthologousGroupsFasta/
$ cd ..
$ ls omaWorkingDir/Output/OrthologousGroupsFasta/
OG10.fa OG1.fa OG2.fa OG3.fa OG4.fa OG5.fa OG6.fa OG7.fa OG8.fa OG9.fa
$ head -n2 omaWorkingDir/Output/OrthologousGroupsFasta/OG8.fa
>s0000lcl|AF0929421cdsAAC9630111 cleaned for r2t [s0000]
MGSETLSVIQVRLRNIYDNDKVALLKITCHTNRLILLTHTLAKSVIHTIKLSGIVFIHIITSSDYCPTSDIINSANFTSM
As you can see OMAstandalone automatically add the species name to each record [s0000].
Now you can run the first step of read2tree
mkdir r2tWorkingDir; cd r2tWorkingDir
cp -r ../omaWorkingDir/Output/OrthologousGroupsFasta marker_genes
cp ../dna_ref.fa .
In real case, there might be tens of thousands gene markers. Instead of copying all of them, you can select top 100-500 OGs, simply based on their file size as a rough measure of species completeness.
Now we have these marker_genes a folder of .fa files and their cdna together dna_ref.fa.
Then, you can run read2tree to parse the gene markers.
read2tree --standalone_path marker_genes --output_path output --reference --dna_reference dna_ref.fa
Perfect! You are ready to use read2tree with your sequencing reads e.g. sample_1.fastq!
read2tree --standalone_path marker_genes/ --output_path output --reads sample_1.fastq --tree --dna_reference dna_ref.fa
todo in the code: id_old = str(record.id).replace("_","").replace(".","").replace("[","").replace("]","")